SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si029996m|PACid:19713322 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si029996m|PACid:19713322
Domain Number 1 Region: 14-59
Classification Level Classification E-value
Superfamily F-box domain 0.0000000034
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Si029996m|PACid:19713322
Domain Number - Region: 194-383
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0137
Family DPP6 N-terminal domain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si029996m|PACid:19713322
Sequence length 411
Sequence
MDRPEGSGSASASAVGDIPEGPLVEILSRVPGKSVCRFECVSKAWLGLIADNRKKLRQAM
QGLFYRTLEYPEGYDITAFELYDLEYIYSFIDLTTRSVPLDIDPGFSFLTELPEIQCLVS
RNSCNGLILFENRHKIYSLPQSTLGYIVCNPTTKQWVAVPTCGSTASFTYTYLAFDPAVS
SHFHLVHFKVGSNDRLVSVNIYSSETGTWSRNQIDEQEELGQSEGWRDYQVRLCMSGGVG
TEGSRCAFVNGFLHLVVWDSGQPKVLAVDLQGKARRMITLPQVAYSPGCYLGQSQGLLHY
TTQGFSDAHQERYQLRIWVLQDYDTQEWVLKDTLELSGENCIGNMWGFFVFNIHQDCNVV
FFTKSGRELMSYDMCRKEVSVIATFEGRNHLTDAFQYVPYFSKLPALTNNH
Download sequence
Identical sequences K3ZTR6
XP_004955708.1.39314 Si029996m|PACid:19713322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]