SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030013m|PACid:19713556 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030013m|PACid:19713556
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000107
Family F-box domain 0.0078
Further Details:      
 
Domain Number 2 Region: 131-375
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000487
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si030013m|PACid:19713556
Sequence length 408
Sequence
MAPPPSPQPPELMEELVEEILLRFPPHEPALLVRAALVCKHWCRLISGPGFRRRFRELHR
TPPMLGFHYRGISDDGRNVGRFVPTAAFRSPRAESRSWRALGARHGRNVGRFVPTAAFRS
PRAAESRSWRALDARHGRVLLRCPGEPFGTDIVLAVWDPITDEKRKLPLLPRNRSRWGAA
ILCSAAGACDHLDCHRGPFLLVFVGSNLGGTCICTYSSDAAAWSQAISTPGTGDCVDPLM
RSALIGNALYFGLVKKTEALRYDLESRQMSWVQLPPTYHNFELRVLTTTEDDGLGLVTAH
SNKIYMWSRKAGPPNTGWTQDRVIELERLLPIDAVLASPDVVGFAEGIGVIFVTANNVLF
TIDLKTCKVKKVCEGRGIRGVVPYMSFYTPALGAACTDEGPSAGGSSA
Download sequence
Identical sequences K3ZTT3
Si030013m|PACid:19713556 XP_004958854.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]