SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030015m|PACid:19713831 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030015m|PACid:19713831
Domain Number 1 Region: 107-357
Classification Level Classification E-value
Superfamily Kelch motif 7.85e-48
Family Kelch motif 0.0011
Further Details:      
 
Domain Number 2 Region: 47-130
Classification Level Classification E-value
Superfamily F-box domain 0.000000000119
Family F-box domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si030015m|PACid:19713831
Sequence length 408
Sequence
MRRVRVSSHNAPVHKLGDAQMALTPKFRLATTNTPAPPPPPEDLQQPAWDTPLIPGLPDD
AALTCLLRLPVAAHGACRLVCRRWHHLLADKARFFSQRRALGLRSPWLFTLAFHRCTGKI
QWKVLDLGHLAWHAIPAMPCRDRACPRGFGCVAVPGDGALLVCGGLVSDMDCPLHLVLRY
DVYRNRWTVVTRMLAARSFFAGGVIDGRVYVAGGYSTNQFELNSAEVLDPDKGVWQPIAS
MGINMASSDSAVISGRLYVTEGCAWPFFSSPRGQIYDPKINQWEAMPVGMREGWTGQSVV
IDGRLFVISEYERMKVKIYDPETDSWDSVSGPPMPERIMKPFSVSCLDSRIVVVGRGLHV
AIGYVDKQPAGGGNSGNRSSSYSVCWQDVDVPKEFSDLTPSSSQILHA
Download sequence
Identical sequences K3ZTT5
Si030015m|PACid:19713831 XP_004955477.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]