SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030017m|PACid:19712356 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030017m|PACid:19712356
Domain Number 1 Region: 17-84
Classification Level Classification E-value
Superfamily F-box domain 0.0000000116
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si030017m|PACid:19712356
Domain Number - Region: 223-373
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0017
Family Galactose oxidase, central domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si030017m|PACid:19712356
Sequence length 408
Sequence
MASPSRPVRRRRKATESQQRSLLALSDDVLEEIFLRVGSPGDLARASTACVAFRRLIAGP
GFLRRYRSLHPPLLLGFLDPGPGGGFQPAEAPHPNAPAARALARAAGFSFDYIPRGRGRR
WHPRDVRDGRVLLYCSPDVQESIVFPDLAVCDPVSRRYLLVPRITDELLASVQVQKQHVQ
FFEAFLVPSGVEQKEEASFRVLGRACCMTKMVALVFSSGSSHWDVGTSESWDDLSLNARP
FAEGLMLRWPSYAYGCFYWKVHLRNKLLKLDMSRMKFSIIDLPPGNADANVVIVETGEGR
LGMIGNLNHVRGDTHVYYASKNEGDSNNEWRMAKTIPLPEHYNCCLVGAPEGYIFLLGVP
KDKGTLGPACFSLGIKTLEIERVSQMGLNYRHVYPYFGFPPSMLPRMI
Download sequence
Identical sequences K3ZTT7
Si030017m|PACid:19712356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]