SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030024m|PACid:19713794 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030024m|PACid:19713794
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000128
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  Si030024m|PACid:19713794
Domain Number - Region: 326-367
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0604
Family Quinoprotein alcohol dehydrogenase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si030024m|PACid:19713794
Sequence length 407
Sequence
MEDTPIRRLPEDTIADILLRLPAKSILRSGATCKAWRRITTAQHFLVARARRRQPASILA
HTYLDAAPWACSSDLLAGFSSEDVALDALPVSSPEDDRQRLLRYPATRLTVPAHCGRLLA
SSDGVLLFKKDMGFYLLCNPITRQWAELPRLPNEYCKGKFYINSDPEYGFYFHQPSGEFR
LLCCSLTRGFWYIVSTGAGKPRHLKLKQEPDLITRFIRPLLTTATMPVALDGKLHWPPIW
RCATGKTRITAFDTVSEMFCQMPGPTSRTPKMMKLFEMEGMLAAADFGEEKHVDLWFLED
YSSQRWVHRQRVASPWKYGSGGRPRNDWGMQSVAVAGDDEGNIILGNNDGLVVYDVRKGE
TVRTVNSVMQRKNRVFVSKHVFKGSTVQHTCFFTPSSADSPLIHSWS
Download sequence
Identical sequences K3ZTU4
Si030024m|PACid:19713794 XP_004958619.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]