SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030043m|PACid:19709573 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030043m|PACid:19709573
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily F-box domain 0.000000000563
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 105-161
Classification Level Classification E-value
Superfamily F-box domain 0.000000419
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si030043m|PACid:19709573
Sequence length 404
Sequence
MPPPPPPQTDLIDDVIAQILMRLPPDEPEHLFHSALVCKPWLRVLYDPAFRRSYRAFHRA
PPLLGLLHRLMVVQGDPEPVSILIQTPPKPSHPPTMAPPRPPPALIDDVTTEILIRHPPD
EPEHLFRAALVCKPWLRVLCHPAFLHRYGAFHGAPPLLGLLHRLQVLDGDPAPRFASTTS
MPAFPHPGSDGRRTRPLDCRHGRVLIHMLEDRAVDLLVWDPVTGDRHGLREPRIDWMAYS
AAVFCGADGCDHLDCHGGPFRVVFVGTDDAVDKIWTSVYSSETGAWCTPTSVRNGGAVYV
QPRRGTIVNAEGAAEWLRCRIIDMEKIMPMAKPCDGDGAYVVGYAEGVGVIFVSTDVGLF
TIELKFERVRKVDEPGVYYSVLPYMSFYTPDHGRLSSLARLTTV
Download sequence
Identical sequences K3ZTW2
Si030043m|PACid:19709573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]