SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030058m|PACid:19709789 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030058m|PACid:19709789
Domain Number 1 Region: 44-94
Classification Level Classification E-value
Superfamily F-box domain 0.00000000034
Family F-box domain 0.0065
Further Details:      
 
Weak hits

Sequence:  Si030058m|PACid:19709789
Domain Number - Region: 342-382
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00785
Family Quinohemoprotein amine dehydrogenase B chain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si030058m|PACid:19709789
Sequence length 402
Sequence
MGLQATEQGSHPPAAAAAAADPDHPPPRQLAAPPSPPAGGDGCPEGSTAAVLPDDILLEI
LSRLPVKALFRFKCISRAWFGFITERLRKIPPTLQGFLYGPTNKNYGHFFNLLGRSVPPV
DPSFAFLTKLPEIERIILMGSCNGLVLFLHSRRSEAHEREDYIVCNPATKEWVLVPGTGT
QCDNELNYSVTAGYLIFDPAVSSGFKLVQFMFGTNMTLLQVHTYSSENVSIQTWVFSAIV
NGMLHLVARLGSDYQVVIVAVDEEGGKHRIISWPEEERGLLVQLGQSQGLLHCTSGHRDD
LGYMTELSISALEDYGTEQWILKDSVSCLQLFGEVNCCIADSTVAFHPDHNLVFFFHLWN
RKLVSYDMDSKEVTTLCRLGGWIPITPYFPYFVESSALVKSH
Download sequence
Identical sequences K3ZTX7
Si030058m|PACid:19709789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]