SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030060m|PACid:19712462 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030060m|PACid:19712462
Domain Number 1 Region: 17-87
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000275
Family F-box domain 0.0076
Further Details:      
 
Domain Number 2 Region: 213-378
Classification Level Classification E-value
Superfamily YWTD domain 0.00000902
Family YWTD domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si030060m|PACid:19712462
Sequence length 401
Sequence
MEECLDAKSGAAAAAADGLPDDAIVEILSRVPARSISRFKCVSKPWRDLIADPLHRKRLP
QTLEGFFCSDGAGAAGGFRWRFISLPGRSAPLAEPSSSFLTKLPGIRNIRLLGSCNGLLL
FEDGGNPATAPAYVVCNPATEEWVAVPSAGCACPDPLEERTDLIFDPAVSPHFHLVHICQ
EDFMGEIEVRAYSSETRVWSDRASQQSSWQDEGGLEQWVNGGAILKSMFGGAFVNNMLHL
VIFLLEEYRIAAVDRGGKTCRIIPWPDKCSFPLVVGQSQGRLHCVGRLEERERNCLKWAG
LSIWVLDDYDTEEWVLKHRVSFLELFGQMSCHYGYNINVLAVHPDRNLIFIVQKSNQKLI
SYDMDSKELHAFHSLGHNYGSLTPYVPNFMELVVTNCNNPK
Download sequence
Identical sequences K3ZTX9
XP_004955703.1.39314 Si030060m|PACid:19712462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]