SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030066m|PACid:19714182 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si030066m|PACid:19714182
Domain Number - Region: 215-369
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00405
Family Galactose oxidase, central domain 0.043
Further Details:      
 
Domain Number - Region: 6-44
Classification Level Classification E-value
Superfamily F-box domain 0.0392
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si030066m|PACid:19714182
Sequence length 400
Sequence
MAKSTPDWSTGLPPELRKVIGKCLASGTDAASFRSVCTPWRDAVPFAAFAPLLLLPFGPD
SGAVTLYSVAEDKTLSLPLPPEARGKVPCGSSCGWLALMDEAASVTLLNPFTGALVELPP
ADENIAAASTMQTMLVSKKGGRWVLHPEDDNASAIALDEMRQFFFNEIVLSAPPDADGRG
CVAMAVLAGSTEVAFCRVGVDTAWTLLQTNLECTVGSVVYCQGRFLAIDSTGEISMFSDI
ANTVTPTATPMPSLSPPEDLSNRSYLEWNGELYVVGAMLDLFRWGLKFDYRVVVCRCSNL
LDPTPAWSRVKDAGDLTLFVSTHFRHSFGGTSVSRFKRNSVYFSDPPYGDQDYLGHSLEI
ANIATGKSEVTKPFHPKVQGFEALGWIRPNLWRGRRYVKL
Download sequence
Identical sequences K3ZTY5
Si030066m|PACid:19714182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]