SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030090m|PACid:19711976 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030090m|PACid:19711976
Domain Number 1 Region: 97-396
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 2.28e-90
Family Transcriptional factor tubby, C-terminal domain 0.00000754
Further Details:      
 
Weak hits

Sequence:  Si030090m|PACid:19711976
Domain Number - Region: 38-89
Classification Level Classification E-value
Superfamily F-box domain 0.085
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si030090m|PACid:19711976
Sequence length 396
Sequence
MPFSSMIQEMKGEIGAISRRGLLRSRSQSTGRVQRVEPDEAAMRESSWAQVPPELLRVVL
AKVEAGEARWPGRGAVVACAGVCRGWRGTVKEIVPVPEASGKLTFPISLKQPGPRDAPVK
CFIRRNRATQSYFLCLGVTDALVDDGKFLLAARKYRRPSCTEYLISLDSKGNGTYLGKLR
SNFLGTKFTVYDAHPPCAGAVVSKGPSAHMIGSAQVSPMKGGPPAGNYPVSHISYEVNVL
GSRGPRKMNCVMDSIPASAIKEGGTAPTQTEFPSSNSSSFASVPFFRSKSGQLDSSGAQN
ESKVALKNKSPSWHQQLQCWCLNFHGRVTVASVKNFQLVASGESAPTPSNQEDDDVILQF
GKVGKDLFTMDYRYPISAFQAFAICLSSFDTKIGCE
Download sequence
Identical sequences K3ZU09
XP_004958613.1.39314 Si030090m|PACid:19711976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]