SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030099m|PACid:19709779 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030099m|PACid:19709779
Domain Number 1 Region: 10-69
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000353
Family F-box domain 0.0054
Further Details:      
 
Domain Number 2 Region: 126-311
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000458
Family Galactose oxidase, central domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si030099m|PACid:19709779
Sequence length 394
Sequence
MAPLPLPPTPTELIDDVTAEILLRLPPEEPEHLFRAALVCKPWLRVLSDPAFRRRYRVFH
GAPPLLGLLHRLQVLQGPPPVRFASTTSMPDFPHPGSDGGQTLPLDCRHGRVLVQMWGEG
EESLVYLVWDPVTGDRHLAPKPDIDWLIHTAAVFCTAVGCDHLDCHGGPFRVLFMATDDH
DLLVKVSLYSSETGVWSAPASLGDSCECYVQHMEDAIQEDRYHLPYVQPRRAAVIGDEIY
FTLRRGHAIIKYDGCNNCLSMINPPPHDAYGIALMVMDDSSLGFVCIEGSSLYLWSRKVS
SEGAAEWVQCRVIELKTIIPVVDPGEVPFVVGAAEGVGAIFISTDAGLFTIEIKSGRVRK
VDEPGDYFSVLPYMSFYTPDRGRLLSLAKASYQQ
Download sequence
Identical sequences K3ZU18
XP_004955406.1.39314 Si030099m|PACid:19709779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]