SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030146m|PACid:19712346 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030146m|PACid:19712346
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily F-box domain 0.00000000523
Family F-box domain 0.0082
Further Details:      
 
Domain Number 2 Region: 129-353
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000209
Family Tricorn protease domain 2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si030146m|PACid:19712346
Sequence length 383
Sequence
MDAADPPPASTLMEELEEEVLLRFPPADPARLVAAALVCRRWCALLAGARFRRRFRELHR
APPLLGFLCNAGPGARFVPASAFRPPGLPRAGGGLLLGWRALDARHGRVLLRWDPGRDAA
SGGVGCPPLVVWDPVTDQRSDLPPLQWAPYPYSWNAAVLCAAGAACNHLDCCGGHFLVVV
VGTNSNEMFAHVYSSEADAWSEPASARHPNDSVDFAPSALVGNVLYFAFQMGTAVLEYDL
GTKEMAVIRLPPLLHFNWQRIALTTRTDGRLGFATADRSAIYLWSREACPGGDARWAQTR
VIELDTLLPAGALSTFSDVVGFVDAIGLIFVRTGDGLFTIDLKSSQVTKVSKDTGFSGIF
PYMNFHTPALGVPSAGEGPSSGA
Download sequence
Identical sequences K3ZU65
XP_004955355.1.39314 Si030146m|PACid:19712346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]