SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030168m|PACid:19710233 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030168m|PACid:19710233
Domain Number 1 Region: 25-136
Classification Level Classification E-value
Superfamily F-box domain 0.00000183
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si030168m|PACid:19710233
Domain Number - Region: 112-284
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00386
Family Serum paraoxonase/arylesterase 1, PON1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si030168m|PACid:19710233
Sequence length 381
Sequence
MSQPEARRRRRSREPRREEPRSPQQLVEDTVGEIVLRLPPDDPALLVRASAVNKTWRRAV
AEPSFPASYRAFHKKPPVLGIFRTDAILIPTTSFCPAAAGYRDCQVLDCRHGRVLLENLD
CGDIDVWNPITGDQYTLPEAPEDISLVCNGAVLCAAADDDCDHLACHTGPFLVALSGEWS
GLTSIDLDYIAPDHFTTTCITVDVVPAALMENALYFIGDFGNEILKYEFDPEEPSLTAID
PPPGVETCCDGVVVMPEADGRLGFAYVEAHRLHMWSMQAGPDGNPQWEKRRVIPLELLLP
PIRRASPYLTGFVHAINCIVVTTEDEVYTIELKSYKTRKICNKDMSYSGFLFTAFCIPDF
AFVPPPPPGPPPPPPPAANED
Download sequence
Identical sequences K3ZU87
Si030168m|PACid:19710233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]