SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030188m|PACid:19710874 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030188m|PACid:19710874
Domain Number 1 Region: 7-80
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000955
Family F-box domain 0.0061
Further Details:      
 
Weak hits

Sequence:  Si030188m|PACid:19710874
Domain Number - Region: 204-347
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000118
Family Methylamine dehydrogenase, H-chain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si030188m|PACid:19710874
Sequence length 377
Sequence
MAPPPLKLFDDLVEEVLLRFPPDDPASLLRAALVCKQWLRIVSGRHFRRRFRSFHRTPPM
LGAFTKLHGFVPTSSFKCQVPAEVRHGRMVLDARHGRVLFHNVRHASEWWDPTLSLWYPI
SGEQLGLPKLPRVPDPHECSSGFAVLCAAAGCNHLDCSHGPFLVVVVAVGLSEVFARVYS
SEVGEWSEPTFAPHINESLRHPDSLYLMPGVLAGDTICFLLDTANAVVKFDLKTREMEWI
HLPVTSYSSWPIALITAEDGSLGFARTKGRTLHLWSMVAGPSEEARWAQSRVIELETLFP
VNALKCTPIMLRSVGIIYFFCTNDRGIYSVDLNSSQARKMPKSFGYPNYAVPFVSFCSPA
LGAASTDEAPRDSSSSA
Download sequence
Identical sequences K3ZUA7
Si030188m|PACid:19710874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]