SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030192m|PACid:19709804 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030192m|PACid:19709804
Domain Number 1 Region: 3-54,82-123
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000051
Family F-box domain 0.0058
Further Details:      
 
Weak hits

Sequence:  Si030192m|PACid:19709804
Domain Number - Region: 102-242,276-346
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000683
Family Quinohemoprotein amine dehydrogenase B chain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si030192m|PACid:19709804
Sequence length 377
Sequence
MAEALTDDLVEEILVRLAPDDPVSLLRAAAVCRRWCRVVSAPVFRRRFALRHRAPPMLGF
LANLRDGDDDDGYDYVTRFVPATPFRPRHAERRDRRALDARHGRVLLATMPCGPDLEVWD
PVTGGLRKLPALPVRSPFSWNAAVVCAAHGSCTHLDCRRGPFLVVFLESDLPDKMRVYVY
SSEAGAWSGPIYGPPSPSYGIELVPTSLVGNGLHFLIDATNSILKYDLTMRSVSESEVPL
AMRNPSEIPLPPGFHSDFAVLTTLEDGVLGFARVENYRLWLWSMETSPEGDAIWVQKGSI
ELETLLGVDASSIQNDYVGFAHGVGVFFVGTEDAWFSIDLKSGQVREEDCGDGDTFGVVP
YTSFYTPDLHQYGLAPL
Download sequence
Identical sequences K3ZUB1
XP_004955378.1.39314 Si030192m|PACid:19709804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]