SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030197m|PACid:19714028 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030197m|PACid:19714028
Domain Number 1 Region: 93-316
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-30
Family Kelch motif 0.0039
Further Details:      
 
Weak hits

Sequence:  Si030197m|PACid:19714028
Domain Number - Region: 14-104
Classification Level Classification E-value
Superfamily F-box domain 0.000157
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si030197m|PACid:19714028
Sequence length 376
Sequence
MYTELTSPSQPPELIRGSLIPALPDDLAVHCIALLPRAAHPSLALVSRAFHALLCRHPEP
LLAARRALRLSDSHILLSLRPPSSASLLFFLLLQHPGWPPLPLPSPPVPVSSSSSVATDG
SRLFLVGGSVAGVPSASVQILDPRARSWSIGPRLSSTREFAAAVVHSGVLFVAGGCVPSS
PFWDEALDLSSPNAKWKTLASPVHLREKWMHGCASLAGKVLAVADRGGLAYDPAAPPAEA
WAPVSPVLDMGWKGRAAVVEGILYSYDYLGQVKGYDPDSDSWSAVEGLERELPKFLCGAT
LANVGGLLYLVWEGKWKGKGKGKGEVRSMVVIEWAGIEVTRAEEGRLRGKVVSRDTVLFP
DVPKGSTITHCIALEL
Download sequence
Identical sequences K3ZUB6
XP_004958664.1.39314 XP_004958665.1.39314 XP_004958666.1.39314 Si030194m|PACid:19714029 Si030197m|PACid:19714028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]