SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030362m|PACid:19712487 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030362m|PACid:19712487
Domain Number 1 Region: 20-63
Classification Level Classification E-value
Superfamily F-box domain 0.0000000196
Family F-box domain 0.013
Further Details:      
 
Weak hits

Sequence:  Si030362m|PACid:19712487
Domain Number - Region: 156-220,265-334
Classification Level Classification E-value
Superfamily RNI-like 0.0247
Family 28-residue LRR 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si030362m|PACid:19712487
Sequence length 348
Sequence
MEIVARRKKRKSKDRDSQGPPDRISGLPDCVLGHIVYLLPTVDGARTQILSSRWRRLWCS
APLNLDCHGFGAGARAACVDLMSRVRRAHGGAVGRLVLSTPRRPAVQPYLDRFLGSPALD
GLQELEFFYHRSLPTALQQPTQPPFPPEARRFASTLSVASFGFCHFSEETARSLVFPVLK
HLELKEACTSVGVGEMVLEELVVEDTPCLERLLFPMLLCRLHVRVIAAPKLEVLGWLPDF
RPRLNLGIDVPREPNTNTFSLMMVMRSVKIVALRTQYLSLDVVINLMTCFPCLTSLYISS
VNRGDEDNNMWHAEQLGRMECINQHLKKIILSGYVMNCMSQVKSSSSY
Download sequence
Identical sequences K3ZUT1
Si030362m|PACid:19712487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]