SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si030638m|PACid:19711094 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si030638m|PACid:19711094
Domain Number 1 Region: 21-72
Classification Level Classification E-value
Superfamily F-box domain 0.0000000432
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si030638m|PACid:19711094
Domain Number - Region: 173-296
Classification Level Classification E-value
Superfamily RNI-like 0.0288
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si030638m|PACid:19711094
Sequence length 303
Sequence
MGVVAGANGKGRQPAEEEGQGPDYISGLPDAVLGDIVSRLPTKDGARTQALSSLWRHVRR
SAPLNLDLRFHPIPLGKVPRVLSSHPGPARRFSTPACYGKLRDAPPSSTSTTTSRLGIGG
ILRRCPHRHSASRALFASPDSASAVSRMESMSACRFSRSCTFRMASSRRVLCMPCFAGCP
VLQRLRLTYNDGCTSVRIASPTIRSVDVGRGSGDLGLQQLVIEDAPCLERLRHDTPISHH
KMMDILVISGPKLSILGRIYDHFPRFEIGTTVFKSLRLGLVLNFMKCFPCLEQLNINVSK
LTL
Download sequence
Identical sequences K3ZVK7
Si030638m|PACid:19711094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]