SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031025m|PACid:19712087 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031025m|PACid:19712087
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000589
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si031025m|PACid:19712087
Sequence length 227
Sequence
MTDRSDGPIGRLPEHLIVEIFIRLPVSEWVQIACVNKQWANIFEGDCLWQTAIARNWPSA
GLQKRWPGPIPRGSPRRRFQALYVSENLVPSGGEIDELVGHTYLYLKEQLERPAMPPSSI
LHGTIIDQFIACGKTGEKAHDLSSKIWLAVIDGLEENQKTFLLLKHLAREGEFFLPFPYS
RSYKVLWRVYDKLFTDFRDCFSGADYHDALSTAKSRFQPVPSTWLGH
Download sequence
Identical sequences K3ZWP3
Si031025m|PACid:19712087 XP_004957247.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]