SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031184m|PACid:19710771 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031184m|PACid:19710771
Domain Number 1 Region: 11-67
Classification Level Classification E-value
Superfamily F-box domain 9.16e-16
Family F-box domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si031184m|PACid:19710771
Sequence length 193
Sequence
MDCSKRSAGAVASLPDDPLVEILSRVPVKSLCRFKCVSKAWRDLIADPLHRKKLPQTLEG
FFFLGDSEWSSTGKLTYLIFDTAASSHFHLVQIEDEDMIPVHVYSSKSGVWSPVRCDLDD
LDLYLVPGLRRACANGMLYVVMSGGMHQIAVMDVEGNIRKIIPVPLRVGDEFWPFSDYVG
QSQGHLHYIYHLT
Download sequence
Identical sequences K3ZX52
Si031184m|PACid:19710771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]