SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031509m|PACid:19713980 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031509m|PACid:19713980
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000837
Family F-box domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si031509m|PACid:19713980
Sequence length 128
Sequence
MENGLPDDPLAEILSRVPAKSLCRFKCVSKSWRDLIAGRLRCRRFPQTLQGFIYGDGEAH
VGYIVCNPATEQWVAVPSSGWSPWPDSKAEEDEDYFTEEDVLTHLISIQLSPRTFSWSSY
GRKVTGNW
Download sequence
Identical sequences K3ZY27
Si031509m|PACid:19713980 XP_012699387.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]