SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031899m|PACid:19714162 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031899m|PACid:19714162
Domain Number 1 Region: 26-74
Classification Level Classification E-value
Superfamily F-box domain 0.0000000327
Family F-box domain 0.0066
Further Details:      
 
Weak hits

Sequence:  Si031899m|PACid:19714162
Domain Number - Region: 178-269
Classification Level Classification E-value
Superfamily RNI-like 0.000149
Family 28-residue LRR 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si031899m|PACid:19714162
Sequence length 375
Sequence
MGRCRRSNCNCKKARTDAGDGSGSSGDRITALPLELRVRIVSLLPYWQIVQLSVLSRPWR
HIHHHTPDVKINLYDFLADGDSGSILAARFALARRAEDTSASSVDTLRLAFAVGDLRMRR
HADRIVALADARDIRIHGGGPVRDAAWTLDLPPLARDLEALARNHVAHAITGPGAAALRK
LCLQNVVIHEWPPHLPSLRSLDLDAVTVEAPFAPGTWCPRLEELDTSSPPRSSTPAPPGR
SPPSFGEITVDAPELVELDVDCCASGSTVDYKSFKLRAPRLHLLCRRNPFAERGPGSVKV
GVIQLRSVYTREMKDYQEQMMRMLEGLLPDLPRESIAGVARPYMTLEECDDSDDDEDEPK
DKRLTCDITALMSGI
Download sequence
Identical sequences K3ZZ67
Si031899m|PACid:19714162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]