SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031910m|PACid:19713741 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031910m|PACid:19713741
Domain Number 1 Region: 7-67
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000419
Family F-box domain 0.0082
Further Details:      
 
Weak hits

Sequence:  Si031910m|PACid:19713741
Domain Number - Region: 122-143,203-328
Classification Level Classification E-value
Superfamily NHL repeat 0.000785
Family NHL repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si031910m|PACid:19713741
Sequence length 363
Sequence
MAPPCPPPDLMADLVGEILLRVPPDDPALLARASLVCKAWRRLLADPAFGRRYRAFHRAP
PLLGFLHEHYTIGGLGTVPRFVPTVTPSSFPQRALDDCDGWRILDCRHGRVLFEIPGQSV
NLVVWDPATGKRQGLPQPPIPHYWSFTAAVLCAVRGCDHLHLPCKVRIVRSHLYSSEDDA
WNASDDQGPGCYTTRKPSALIGDDIYFILAPWDTILRYSLGKNCSSIIPPPEAHDIPEGV
ALMPMEDGSLGFADVLCSRICLWSWNAGPDVVAGWVRCRDIELQTLTHFRNYVEVVASAE
GFGTIFVSTDDGVFTIELKSGRKWKVGERGEYFAIFPFTSFYTPGIVLALYLDQHIAVAS
RGD
Download sequence
Identical sequences K3ZZ78
Si031910m|PACid:19713741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]