SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031914m|PACid:19712099 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031914m|PACid:19712099
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily F-box domain 0.00000000301
Family F-box domain 0.0093
Further Details:      
 
Weak hits

Sequence:  Si031914m|PACid:19712099
Domain Number - Region: 135-222
Classification Level Classification E-value
Superfamily L domain-like 0.00085
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si031914m|PACid:19712099
Sequence length 408
Sequence
MPPQASRRRPEGGDGYAADGVDRLSDLPEELRLEILGRLGSAREAACTSVLSHRWRGLWT
RLPDLAFRGVGIGSVEAALAQLAGSPALDLLNVCVEEHVNPERISSLLRAAAPLAPKNLT
IASEYGPRGEGAVDLPCLDRTASLTISLVEMSLVPPQAGEFAALTSLSIVWSSIDVAALL
PLCPWLRVLHLQKCFELGAHAVLHLPLLEELLLREDFLESIDIDAPVLKKVEVEVFVDEE
LSVSFSAPMVELFDWVLVYHQFDVAFGRLWRMNSLDILAEGHVFGPMVLHLLRIRPVIQM
LRISMEENDECKEKFPCSRNCQCKQPNNWRSESVALTGLEEIEIVGLKGKDHEVDFLKLL
LRCATKLERMTVRLYDGVSPSKSECTKIRHVFKEYPDVECVVYSKYGK
Download sequence
Identical sequences K3ZZ82
Si031914m|PACid:19712099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]