SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031925m|PACid:19711731 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031925m|PACid:19711731
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily F-box domain 0.000000000131
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  Si031925m|PACid:19711731
Domain Number - Region: 109-335
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0785
Family DPP6 N-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si031925m|PACid:19711731
Sequence length 358
Sequence
MAALPALMEELVEEILLRVPPEEPAHLIRAAMVCKAWCRILSDGGFRRRYSRFHRMPTLM
GYICSVFMDACLQFVPTTSFSPPLPPTSCYYRARDCRHDRVLIQDDSPSFIVWDLITGNR
QHLSSRPCAHHHQTYFSSNEAVLCARHQHGCDHLDCHGGPFLVVSVKTVHDAGAAEHDAT
YTCASVYSSETGAWSAETCTTHDYYYDVGGCMKRSLLIGDALYFTQAGLSVIHGLSVIDT
PLVSHKQAIPIDVDGCIGIVQYDGNCICTWSRQVDLNGLETVIPTWHRLLYPVDTIRFVE
GTNTVLLCLGNNDRDRDLGVFTLNLKSRQVTQVAERWDDDVLPYTSFYAPGTTHLCLS
Download sequence
Identical sequences K3ZZ93
Si031925m|PACid:19711731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]