SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031942m|PACid:19710521 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031942m|PACid:19710521
Domain Number 1 Region: 15-64
Classification Level Classification E-value
Superfamily F-box domain 0.00000000811
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si031942m|PACid:19710521
Sequence length 292
Sequence
MGENRRRRRPGGMLPPPLTGEGEDRISGLPDELLHIILLRLCSPRSAARTSVLSRSWPHV
WAHPSSRLAPWLRFASQQRLVGALVVCVPMLIGSLHKPGVEGEENEIELPACEGAKTIKL
RLDLQWRLRLCPAGIMDGTELTALVSMLCPRLRKLSIQVLLVAVSDVSIRSDTVESLWFH
VENIGRLDFVTPRLEVLNASRAIEVHISAPKLAEVVWNNGTYDPRLHQFTDASRHLRLLD
ISCNSLVASLLQRFDTVGKLKLSVSISQRNSCPLSCPCRLAESYKIDDITLD
Download sequence
Identical sequences K3ZZB0
Si031942m|PACid:19710521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]