SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031944m|PACid:19711131 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031944m|PACid:19711131
Domain Number 1 Region: 8-62
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000445
Family F-box domain 0.006
Further Details:      
 
Domain Number 2 Region: 121-263
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000327
Family Galactose oxidase, central domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si031944m|PACid:19711131
Sequence length 376
Sequence
MAMAALMDELIEEILRRLPPSEPGCLVHAALVCKRWCSIVSDAGFRRRFGEFHRAPPTLG
VVYNAVDGDAYVASFRACASFPHRADRRGEAVLDCRHGRVLLRCMPPVGENLNLPSASTA
IHVWDPATNEQWQVPLPYLYPYKFSDVVVLCAATASGTCDHLDCHGGPFLVVIVGTDLKD
MFVYTYSSGTAAWSEPSSIHLDAALNSHSMLRPGLVIGDAIYFMHGEQHMILKYDLGGHV
ISMIDPPFSLHAQGKVSLVATKDGGLGVAYVKGCNLHLWSWRAAGSNGVKRWVNEQVIKL
DLAASDTTGGPSTDELDVVGFGEGTDIIFGTAKDGIFVVWRNTGRVMKECGRTAMPFRSL
KSMFCYQNFYTPADCV
Download sequence
Identical sequences K3ZZB2
Si031944m|PACid:19711131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]