SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031949m|PACid:19713693 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031949m|PACid:19713693
Domain Number 1 Region: 13-73
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000183
Family F-box domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si031949m|PACid:19713693
Sequence length 370
Sequence
MGEAGAKKPQLTGPLSRLSEDNITDILLRLPAKSVLRCGAVCRAWRGITTDPGFLAAHAR
SRPGDILYTRDEGYYFLCNPVTRLWADLPRIPRAHQPQQDGHYYVSVNYIEYAFYFDIPA
GEYRAGLVPSHLTSTGTWCILATGAAEPRPIDTHAAEAAGITELVPCLRTSVSMHVALHD
RLHWPPHQASSAMGTTTTEMVVFDMSSETFHLMAGPPTTTGHVDEAIRHGWPACGRRFWE
GGAHRPLVPRRLQQQEVGTPAPSCYAVGTRQRKAARTPSTALGIECRPLEPKDLLSVAAA
GDGEGNIMLGPDWGLVVYNVERKTVKTVDPVATLERPDVVLSRHVFKESLQQHSFFTAQP
NVHLASKVHF
Download sequence
Identical sequences K3ZZB7
Si031949m|PACid:19713693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]