SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si031969m|PACid:19710727 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si031969m|PACid:19710727
Domain Number 1 Region: 112-341
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000116
Family Ngr ectodomain-like 0.068
Further Details:      
 
Domain Number 2 Region: 7-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000563
Family F-box domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si031969m|PACid:19710727
Sequence length 404
Sequence
RAAGGAVDQLSVLPDGLIHTVLSFLPAPEVVQTCVLSQRWRSLWRSAPRISIDEQDFGIS
LMIERDDALEVKWARLEDFATNLLLFHDNTSSLGEFRLSSRVYNQRHVDRWIHRGIEYCP
SVLIILILNYCRFKLPPVVGSNFCHLKMLRLCSVDLGSHFADLLCSACPVMEDLKLGNCE
FSGNSSQVITSPTLKKLELESCVNNTGYPLVITVPSLAYLCLCYGYYEAGISLFKMDSLV
RAKIYVTEYETLSQQTERELLCSLYNVTSLELVGFGAEEMLIEKSDKFPIFHNMRTLDLH
GCFLDEYELYDKLEALGSFLQSAPCLEKLILKYCMFHSFSDSEWEMERKIITLHREEVKT
FQCQQLKLIEVVYDHDHDHQLIGRLGRSLPDASIKLKKLERFST
Download sequence
Identical sequences K3ZZD7
Si031969m|PACid:19710727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]