SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032001m|PACid:19709839 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032001m|PACid:19709839
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily F-box domain 0.000000235
Family F-box domain 0.0077
Further Details:      
 
Weak hits

Sequence:  Si032001m|PACid:19709839
Domain Number - Region: 155-292
Classification Level Classification E-value
Superfamily RNI-like 0.0259
Family 28-residue LRR 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032001m|PACid:19709839
Sequence length 400
Sequence
MGTDSEGDIAGGCRGSGTDHFSGLPDHLLHSILLRLPGTADAARTSVLARRWHDVWAQLP
ELSLSTAQGHAAVDATLAAHSAPTVRRLEIKTPPQHNSSWWRRADIPTDRVSSWLDFASL
HLAGELRLDIPYCTKATDEALIQTMMQFRLPPAGVFSALATLGVANVCVDGQELEDVLCS
RCPWLKQLVLYWITLRDGAHVPSIRSDSLERLEITASQFQVCLQIATPELQTFYTLSVSD
FHIAAPKFSEVNCKTSTGYDPSRHHFTESGHHLQRLVIAVNYGGLQLMQRFDNVKELELD
VHITQDDYPCKSWSGCPCSRLENRTTNNIVLDSLEEAEIRDYGAAADKVELVRLFTKLSA
RCEKRVSITVLEWAWRKDMHEKIRSICPPNDKVEIVVRSA
Download sequence
Identical sequences K3ZZG7
Si032001m|PACid:19709839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]