SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032005m|PACid:19711077 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032005m|PACid:19711077
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily F-box domain 0.00000000183
Family F-box domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032005m|PACid:19711077
Sequence length 372
Sequence
MDAIPDDLLELILLFISSSVVLVRAASTCKQWRRIIAKSNFLRRFRCLHRPPVAGYYYDS
KRFSPSSPSVVDGCHFSLDFLPDSSLYPSAWSWRIVDSRGSLLLLDHYNHKDGSRDMVIC
EPVTKRFQEIPLSTVSARRDNTVFLLDGSDVRPDGISMSSFRVLCLADYGNRIHAEVFTS
GDSWKETSTWSRSMNIIGVAMGSIYWYTGGRKVVTLEQSSAEFSSFKLPEIEDWDRHYHR
LAVTAGHDGMVRIVVGVTGGDMKVFARQPGGSCEWVLKKRIPLLMAIRSLPWREPWYFNQ
LPISYHRTGAVVIITTGVSLSPRLTTPLMFRLDIETMALERMPDRNMGIAYPCELPWPPI
FRGCTDDGDSAT
Download sequence
Identical sequences K3ZZH1
Si032005m|PACid:19711077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]