SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032019m|PACid:19710005 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032019m|PACid:19710005
Domain Number 1 Region: 4-49
Classification Level Classification E-value
Superfamily F-box domain 0.000000222
Family F-box domain 0.0059
Further Details:      
 
Weak hits

Sequence:  Si032019m|PACid:19710005
Domain Number - Region: 121-244
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0282
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032019m|PACid:19710005
Sequence length 369
Sequence
MEDTTSTATQEQSWSSLPADLLKTIVNLLPWSSHPSFAATCKHWRSAVSPFYPAWITPIL
LNATDVGSTNIRYYSPYYHKNFEVDKTLETPNANFSCANRHRLTLCQDDGTELIVVHTNL
VTGKTYSLCPLERTGFDVYDGAQRMFGINRLEIYRAIESDGGGWYDWQFSEYNHDRPRLN
VSPMTNPVFHRGLLYLLDVDGRLAVYDDSRLDEGFKILDVPKGFGFECDGYYLFESDEGE
LMAVLMGYRGPLVHVVKLNEQNMEWEEVKSLEGRALFTGTLTTTMVKTGMKWMQNKIFVP
RLYDWPETIRVDLVDREGELAFVPLSAGAAQHGGAEGRNIWACGLGPEEAPEFWETIKVD
YSIWVNFRN
Download sequence
Identical sequences K3ZZI5
XP_004959432.1.39314 Si032019m|PACid:19710005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]