SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032020m|PACid:19714188 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si032020m|PACid:19714188
Domain Number - Region: 6-33
Classification Level Classification E-value
Superfamily F-box domain 0.0085
Family F-box domain 0.013
Further Details:      
 
Domain Number - Region: 77-260
Classification Level Classification E-value
Superfamily RNI-like 0.0942
Family 28-residue LRR 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032020m|PACid:19714188
Sequence length 362
Sequence
HLPRHPSAARTSVLSRRWRDLWKHLPELSFRGIAHDALEVALAQFSIVAWVRASDELVAV
EVPSFARATSIRLRLYDLHLTLPAQGGEFPVLEKLSITAGRFDTSAIISRCRCLRVLEVG
CWDIDTITVHSATIEQLLVTGEAQLRGVDIVAPLLKKITLGTSFSISRYGPLDVLEGIYG
IGMWYLNRLKLGTEENFFVLGLDLDRPYSVTHMRNLQEMFQLPNISVLELRVETRGHVYG
AMAVNLLRICNAIQRLKLYSSILQYFRRTDEACPPDCPCNQPQNWRSQNISLMNLENVEI
EDFKGSCHEVDFLKLLFRCAPLTKVTVKLASKVVTSSRGCKEAYNIFKANPTVECYVFRK
RG
Download sequence
Identical sequences K3ZZI6
Si032020m|PACid:19714188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]