SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032059m|PACid:19709217 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032059m|PACid:19709217
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily F-box domain 0.000000000183
Family F-box domain 0.005
Further Details:      
 
Domain Number 2 Region: 206-361
Classification Level Classification E-value
Superfamily RNI-like 0.00000706
Family 28-residue LRR 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032059m|PACid:19709217
Sequence length 521
Sequence
MARCRHYGNNVSPPSPPSVNGGAPSLLHYGGGHDDDDLIDGGGSSDRPAKRPRAEDHDCI
SKMPDDVLIGIVSRLTIRDAVATGAVSARWRDLWKQVTRISLRPRHILPPGGEGDAAAAA
AAGALSRDARRLAGAASSVLRQHHGAGVDRLVLALPLAPSVHAAVLDQAMEFAASAGTKE
LHLSLDNGEHPASGGPPPYDFPHWRFAAAGRLRSLLLCDVSLAAAAPAAQRSFEGLARLT
RLGLTRVAVDDAGVASVLSACAALTVLELSKCRQLVHVAASHDGLLVLRVRSCGGLKSVA
VASSTLLELAYTGHKVDIVCRRTPAMVRLVLYVTNGCPLDCVATGGGGAALPNLRQLFLQ
FPSPLHALQHGWRFEGLNKIVLLFKTPWRKHVASVASLLAAAPLVKELRVEAYSHLPVPP
PNKQGIQWPNRCLPKKLKSIVIGGFSGEPELMELVDFLLWRSPAMRRLTIDTHRRHAVPS
NGVRCWRREETEDTLRCYYARGVLWTHLAPKIPSTVKFTII
Download sequence
Identical sequences K3ZZM5
Si032059m|PACid:19709217 XP_004958943.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]