SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032070m|PACid:19712952 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032070m|PACid:19712952
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000196
Family F-box domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032070m|PACid:19712952
Sequence length 379
Sequence
MAGLPDDTIADILLRLPAESVLCAGAVCKAWRSFTTDPSFLAAHARLQQAQVVMYSYLDE
GPYELALDVVPFSGDDDEAARRRLIRYPRTTRTRFLLLASCNGVLLFRKSHGSFLSFLLC
NPVTRQWAELPRVGRFGEAEYQYAFYSHQPSGEYRLLLRRGLSWLILSTGAAEPRRVDMP
PGTSITNSLVTAPPVALGGRLHWPPRVVAGAGMTTTTSEMMVFDTVSETFHRMAGPPTAT
ADMVKLFEMEGRLAAADFGEEEHVDLWFLDDYDVGRWERRHRVATAWEPDGVSRGPPQEA
GDLVCVAAAGDGEGNVMLGSHLWLAVYNLRTKTARTVDSVVEAENDVLVSRHVFSASLVR
HPSFAARSTADLGLTFSWS
Download sequence
Identical sequences K3ZZN5
Si032070m|PACid:19712952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]