SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032092m|PACid:19709938 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032092m|PACid:19709938
Domain Number 1 Region: 17-85
Classification Level Classification E-value
Superfamily F-box domain 4.71e-16
Family F-box domain 0.0092
Further Details:      
 
Domain Number 2 Region: 205-345
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000262
Family Galactose oxidase, central domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032092m|PACid:19709938
Sequence length 364
Sequence
MAPPPNPHSAPDAGAGVLRLPLDAMYEILLRLPARDLCLFRAVCRRWRSLLSGPHFITAH
AARHPGPLVVTGYDASRYHSDYPNRGVLCDIMDLSGHVLKRVGMTQEGQLAGEWVMYIQL
DLICTGRGFKASYELLNSATGSVCALPKGLAKEHASHEQHYYLTFIAFRKVASTGEYKVL
RVLDNPSDYAPLQLYEVFTLDGSSNSRVVVGGVVYFLSYVPDCVTSFDLETEDWRQALRG
PLSGLMDNNSYWFDLSMATLSGCLVVVHRKCASVDLWFLVDFQRGLWVKQHSIPTSVPRA
KYQVGPLLVLDDGRIVLIYLGDKGLIRTYNPRTNTFTGIAEMGCCFAVGLYTGNLLCLPS
SASK
Download sequence
Identical sequences K3ZZQ7
Si032092m|PACid:19709938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]