SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032093m|PACid:19709942 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032093m|PACid:19709942
Domain Number 1 Region: 14-59
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000863
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  Si032093m|PACid:19709942
Domain Number - Region: 296-332
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00942
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032093m|PACid:19709942
Sequence length 337
Sequence
MDCPRGSAVAGLYDDILVEILSRVPVKDLRRSKCVSKPWRDLISDPLHRKKLPQTLEGFF
HGGRRSFGHFTCLTGTGESVPPVDLDPSFSFLTEKLPGVERLVLLDSCNGLLLFGCNRED
RFGYIVCNPATEECVDVPASSCSCPPPPPFGESNDVYNGERYAHTFLIFDPAASVHFHLV
QFWNDVSMEEIEAVHSASKWKRGEKGGEWGQWGQAMLKFTFGRAFINGLLYFIVYHVQKS
EALILACISMDLQLKGFRIYFTQLSVWVLEDNDTQEWILKHNVSCSQLFGFLSCPAHDLD
IVAIHPDHNSVIFVQRWNRKLVLYNMDTKELHPLRSL
Download sequence
Identical sequences K3ZZQ8
Si032093m|PACid:19709942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]