SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032104m|PACid:19710621 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032104m|PACid:19710621
Domain Number 1 Region: 15-74
Classification Level Classification E-value
Superfamily F-box domain 0.0000000107
Family F-box domain 0.0093
Further Details:      
 
Domain Number 2 Region: 162-292
Classification Level Classification E-value
Superfamily RNI-like 0.000068
Family Cyclin A/CDK2-associated p19, Skp2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032104m|PACid:19710621
Sequence length 493
Sequence
MEPSLHGAQLAAKSSEDDAGMDRLSALPNDVLLRILLRLEDAAVAGRTSVLSSRWRRLWA
LLPELRFHSSREPRLIASALLAHEAALSCLDVGAEDAAPESVAAWLPVAARRLSGSLVFT
NRVPGKKNANEDGEERGAFELPCLANATGVSLDLGCLGVSVPRAGVFARLTELSLSRVQF
RGGPCALGDAVSSRRCPCLEKLTVRDALGPSDLAIRSDSLRHMELADVRGLRRLTVVVPA
LEHLTVVACFYHHHPNRPVANITARQLKELRWGDMFDRRSVQLGKMKHLQCLCPDILLVY
GSSPNRSCIELLRCFKVIQKLSLTLIYPPDIDDQPYLLGDMKILPGATFLHLSLTSNGHA
FGASLFHVLRLCSGTRKLALKLFSDSLEEQNACPPGCICVEQQNWKTEELLLNQLRELEI
TEFRGSENEVTFVKQLFKWATVLKRMKLTFNSLVKESVAERFYKILQSFSRPEICMEFYM
YKDMMEVLYAPED
Download sequence
Identical sequences K3ZZR9
Si032104m|PACid:19710621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]