SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032153m|PACid:19709204 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032153m|PACid:19709204
Domain Number 1 Region: 56-97
Classification Level Classification E-value
Superfamily F-box domain 0.0000000144
Family F-box domain 0.0029
Further Details:      
 
Weak hits

Sequence:  Si032153m|PACid:19709204
Domain Number - Region: 150-213,251-454
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0248
Family Tricorn protease N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032153m|PACid:19709204
Sequence length 468
Sequence
MNNLFDVVALGPKYLWSLIFRILPKLLGLLVSLMKKFSKDKHFHPPLMELETAIGTLQEL
PQELLMDIFATLEIPDLIRAGSVCSSWHSAYTCLRNLGTYKKSQTPCLLYTSRSAGENVA
CLYSLVENRTYKLTLPEPPIRRRLLIGSSNGWLITADERSELHLVNPITGEQVALPSVIT
IEQVKPITDGSGIIRKYKLSYYCREMDEGPEIFALDKLREELYFKAFVFPDHCTRSFFVV
LIHHPRFQLSFARLGDDKWTWLPQNTQYRDCMYKAGLLYALTALGEIDAFDLTASTVTMK
VIMNKIDRYPYAWKSWYIIWAPWGDLLQVWRSFGVPQYKDADGDVPEDGPAMHWPFFRTT
KVTIYEVDLKASALVETKRLSNHILFLGHNNSLCLSADEHPQLKENHAYYTDDRSEPPVA
LKNVHRDIGVIDLENSSRKKIVSHIWSNWPCPTWITPNLTKMNLAFSK
Download sequence
Identical sequences K3ZZW8
Si032153m|PACid:19709204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]