SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032154m|PACid:19710156 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032154m|PACid:19710156
Domain Number 1 Region: 64-264
Classification Level Classification E-value
Superfamily L domain-like 0.00000000748
Family Polygalacturonase inhibiting protein PGIP 0.048
Further Details:      
 
Domain Number 2 Region: 38-72
Classification Level Classification E-value
Superfamily F-box domain 0.00000085
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032154m|PACid:19710156
Sequence length 271
Sequence
MQCTGDPSLPCENNRVLVKGAEMMQPETTMKRFGGLTSTVDRLSALPDALLHAILSFLPA
PQVVRTCLLSQRRMTHSALGERWARFEDFATNLLLSLDNNWIRRGIEYCPAALHVLIPDY
GHSFKLPPMASSSFHRLKRLRLVNVDLDGQFADLLSACPVMEDLDLAFCKFPGNINCSQG
ITSSTLKKLVWNYCENSTSHPMVITAPSLSCLNLTYGCYQAGITLSKMESLVEAMIEITE
TLTLSQNAQRGLLCSLFNVTSLQLMGFEAKL
Download sequence
Identical sequences K3ZZW9
Si032154m|PACid:19710156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]