SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032156m|PACid:19710751 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032156m|PACid:19710751
Domain Number 1 Region: 10-62
Classification Level Classification E-value
Superfamily F-box domain 0.00000000576
Family F-box domain 0.0083
Further Details:      
 
Domain Number 2 Region: 174-483
Classification Level Classification E-value
Superfamily RNI-like 0.00000033
Family Cyclin A/CDK2-associated p19, Skp2 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032156m|PACid:19710751
Sequence length 487
Sequence
MADNRSVGVSCPGGDRISDLPDNLLHHILVLIPLVEAVRTCVLSRRWGGVWTRLPRLLFQ
DVDAAAAAAPRVRRFPDLVDGVLRGYADDVDIDDLFISVDVAAGVDDPVRLAAATAALAA
PRVTARFGIFLSPDAVNLYMVGEATLQLPCFPRATEFSVTFMGVDLRMPETGTFARLTKL
YLAGVRFTDDGEGISDAVSSRCPRIRVLELLMVDGLRVLTVASQSLLSLRLSAIMELERL
GVVAGNLREMVVDTCFVLNNAGALMLLSVPALEKLHWEDCCPGQLLPWKLPGCLRRLVVT
WLKLECLVDAAGGSSNFMRILQLFPRVHTLRLEVPIAPDQLDQNNPIENVNLPYCSELEF
IANQTKHKFGPTIISLLKKSSCVRKLSLQMFRREQAGYIPCTSDCNCRQLSIWRDKGVDL
ISLEWVVMYGFSETQDEKSFIYYIMRKAKRLRRVSLVLSVGVNPTRRFLRKLCKLSMSGC
NIEFYSC
Download sequence
Identical sequences K3ZZX1
Si032156m|PACid:19710751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]