SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032188m|PACid:19709908 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si032188m|PACid:19709908
Domain Number - Region: 4-66
Classification Level Classification E-value
Superfamily F-box domain 0.00014
Family F-box domain 0.0089
Further Details:      
 
Domain Number - Region: 64-132
Classification Level Classification E-value
Superfamily HCP-like 0.0146
Family HCP-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032188m|PACid:19709908
Sequence length 165
Sequence
MVARWHPPSLTVLPTEVAIEIAIHLVATLEWPMDDLRSRWMTCSFMRHMCSDRAIGRGVA
LDRFRCAMLWNESDRYNTLVASLIQPPPPCLDDLDRAAAGGHNVAAYVVALSLYRDNGGA
GDDDTARQYMRRVEGGRIMGGGGRTRRMRMLCNKGVGYAASRLRT
Download sequence
Identical sequences K4A003
Si032188m|PACid:19709908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]