SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032190m|PACid:19711803 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032190m|PACid:19711803
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000576
Family F-box domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032190m|PACid:19711803
Sequence length 252
Sequence
MAPPRRLPELIDGATEEILLRIAPEEPAHLVRASLVCKLWRRLLVDPAFVRRYREFHRTP
PMLGFFQNQLAAADRVHAPWFVPTTSAPPLPQLAFEYSTGWEVLSSCHGRVLVGHGSIGM
NLVVWDPVTRLRQRLPMPRMRLCFNYSYAVLCAVGSCNHLDCHGGPFLVVSVGSCPVCSS
LHLWSRKLDPKGSAGWVQCRVIDLEKLFPINNPRSQPRVIGFAEGLGVIFLWTDVGVFMM
ELKSGRKRKERN
Download sequence
Identical sequences K4A005
Si032190m|PACid:19711803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]