SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032244m|PACid:19712694 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032244m|PACid:19712694
Domain Number 1 Region: 156-347
Classification Level Classification E-value
Superfamily RNI-like 0.00000000366
Family 28-residue LRR 0.074
Further Details:      
 
Domain Number 2 Region: 23-64
Classification Level Classification E-value
Superfamily F-box domain 0.000000123
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032244m|PACid:19712694
Sequence length 486
Sequence
MGTIAGDEWTRRLEDEEDEELVDRISGLPDAVLGDIVTLLPTRDGAHTQVLSSRWRHVWR
SAPLNFDSNADSPRTIRGNVRDSEISSALSAHQGPGRRFRHEFPYVDTGTRSAAKLDCWL
RYPALDNLQELVFHYGIRIPRGWSSLPPPPPLPESVRRFSPTLRVASFGGCAFPEVNAAS
APLHLPVLKQLSLTHAKISEKSLLALLAGCPVLQSLLLSYNSGCSRVRIASRTLTSIGVN
PGRGDSRLQHLILEDAPCLERLLVFSSGTRKIMDISVISAPKLDILGPLSDDFSRVEFGS
TVFQGPLVSIVTVVPSVKILALVNGHPSMDVVIGFLQCFPCLEKLYIKTKLVGYENGWRD
EYHNNLVSTLDIRVKKVVLLNYRGDKSHVKFAKLFVLNARVLESMVLELVEGIVPSTEWI
ERQHKRLHTKNKASTSAQFDFVGHDVRSRLFGNVNEAPAHVGYVNEAQAHDLSTADPFVR
FRDWPC
Download sequence
Identical sequences K4A058
Si032244m|PACid:19712694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]