SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032245m|PACid:19709898 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032245m|PACid:19709898
Domain Number 1 Region: 36-66
Classification Level Classification E-value
Superfamily F-box domain 0.000017
Family F-box domain 0.017
Further Details:      
 
Weak hits

Sequence:  Si032245m|PACid:19709898
Domain Number - Region: 315-357
Classification Level Classification E-value
Superfamily YWTD domain 0.000994
Family YWTD domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032245m|PACid:19709898
Sequence length 380
Sequence
MPIPSPPPIWQRAAPPSSPTTGVGGSEGSAVGGLGFPEDPLTEILSRLPAKPLFRFKCVS
KACISLTCWGRSMPPVDPNFTFLTKLPEIEKISLMRSCNGLVLLRHTPFLDPNDTKALGY
IVCNPATKEWVDVPNSGWTLKPLHEEYYNAEDAHTITYLFFDPAVSLQFKLFQFCQDFSM
NVLQVNTYSSESGVWSGRAVECWSHEAMRSRIGSAFVNGMLHWTIFCRSAQHNALVAVDG
EGEKCRIIHWPNEERGLLVFLGQSQGLLHCMSGRMDDFNKFTELSIWVLEDYDAEKWILK
HSVSCLHLFGEPSCCVHNYHIAIHPDHNLVFFVQRLNKKLISYDLDSKELSVLYTLEHNC
AFITPYVPYFVESSVLVKKS
Download sequence
Identical sequences K4A059
Si032245m|PACid:19709898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]