SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032268m|PACid:19711232 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032268m|PACid:19711232
Domain Number 1 Region: 13-71
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000955
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si032268m|PACid:19711232
Domain Number - Region: 132-275
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.034
Family Galactose oxidase, central domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032268m|PACid:19711232
Sequence length 382
Sequence
MDAPMPPPPLRVPPHLPDEVVEDILVRVPADDPARLLRSALTCKRWARLMANRGFRRRYR
ERYRGAPPVLGVLANLTLTGGVARFIPNPTCGFRPARDDLRGYRAHDARHGRVLLNRLPG
TPAPHRDQESALAVWDPTTDQLRQLPLLKRPHQVLNWNAAVLCGADAGAACDHLDCHAGP
FRVVFVGIDSERIFASVYSSEFGAWSDATSADHPGDDLDIASPGALAGNAIHFVFLRGTR
VLKYDLGTRKMYHLRLPRMLAYGSRIVLMAMEDGKLGFAELWLQYTVLRLWSLELSPNGL
DGAWVLGRSIELNKHLPADAFLPGSMPCVVAFADGAGIIFLKMIDGLYGLDLKSARATKI
SMASGFYDIVPFVSFYIPGNTT
Download sequence
Identical sequences K4A081
Si032268m|PACid:19711232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]