SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032279m|PACid:19710250 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032279m|PACid:19710250
Domain Number 1 Region: 157-378
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000388
Family Cyclin A/CDK2-associated p19, Skp2 0.029
Further Details:      
 
Domain Number 2 Region: 15-57
Classification Level Classification E-value
Superfamily F-box domain 0.000000000235
Family F-box domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032279m|PACid:19710250
Sequence length 496
Sequence
MAGNRKVAVGGRGDDRLSDLPDGILEHVLSVLPAADAVRSSVLSRRWLRAWAHAPALNLS
DERLQDRFLGFAREVLARYGAPDVPALNVTLGCESNLGPAAATAWLRDAMERVVSSVSVS
VMAPGPLCPLTLPRGLRAKSITLVPSGISFQHGPLVLPGPDAPTSFGALTELSLSRVRLQ
ERVRPLGEFLSSCCPRLRKLLLSKVSGGLVAGGGLRLWPLVLHLDMLEELVVDRVESFNK
LQVVSANLRVLGVHSCFGSVSQWGIYTVVEISAPRLEHLSFLNGSHCIRCLSGLLFYLPG
NEFGSTSAELDHVPQLPNIRVLSLRLVAILRFINCPIAPIIFSFLKRCPNLTRLHIDLSM
LHQFSRLDPEYLTGSGWKACRDQLELGSLREIRISGFTGTDCEMELADVLFGVGVARPAL
ERISIALFPQVRQGMNGSPVCCVGATSPAFKRMPMSFPQLLRHMDSIGTKMKAQFPLVGG
YWETVPRKELTWTRTC
Download sequence
Identical sequences K4A091
Si032279m|PACid:19710250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]