SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032283m|PACid:19712788 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032283m|PACid:19712788
Domain Number 1 Region: 18-70
Classification Level Classification E-value
Superfamily F-box domain 0.00000000752
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032283m|PACid:19712788
Sequence length 305
Sequence
MPSPLCRCLEAPASPRQLAALADDLLEEILLRVSCPADLARASAACASFRRIVTDAAFLR
QYRSLHPPLLLGFIEKVSSGFHPAEAPHPNATAARSIAHPAAGFSFDYLPPTRCNRKPWD
ACDVRDGRVLLKSGPVGYTGFNFPDLAVCDPVFRRYRLLPPIPDDLLASVHIKQQIFPSF
QAFLVPSGEEEDGTSFRVIGRAYCGIKSAVFVFSSGSGLWSVGTTWDDLNLRGSVLLCRS
YAYGYIYWKVMQANKLVKLDINRMDFSTIDLPSHYDERMLSLWRQEMARLGKRRERLPMD
VCWRL
Download sequence
Identical sequences K4A095
Si032283m|PACid:19712788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]