SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032341m|PACid:19709565 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032341m|PACid:19709565
Domain Number 1 Region: 13-63
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000458
Family F-box domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032341m|PACid:19709565
Sequence length 385
Sequence
MACSKRSSTAVTAGLPDDPLVEILSRVPAKSLCRFKCVSKAWRDLITDPIHRKKLPQAME
GLFFMESWIWCAGAGCEEEQFSFVDLTARSVPLEIDPCFSFLTEMPGLRVLALHDSCNGL
LLFEHRSDLDSNDVLGFIVCNPTTKQWVAVPTCGCPPPSSYDRHIYLAFDPAISSHFHLV
QFHREDDEDEEEWESHEPVMSVHAYSSESGIWSHSQTDWDEHDRQGLKGWHQPCFETYEG
PRHAFVNGMLHLMIWDEDLDQDQVLVVDVKGKTQRVIPVPTVGVVGEGVWRLQHSDYIAQ
SQGRLHYFSEVSDLYSEQGYQMWVLQDYDLQEWVFKHHNRKLIAYDMESKEVSVFATSDN
QILHRSIAAPYVPCFSESPVLTNKH
Download sequence
Identical sequences K4A0F2
Si032341m|PACid:19709565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]