SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032346m|PACid:19709892 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032346m|PACid:19709892
Domain Number 1 Region: 22-63
Classification Level Classification E-value
Superfamily F-box domain 0.000000000235
Family F-box domain 0.0062
Further Details:      
 
Domain Number 2 Region: 176-277,306-382
Classification Level Classification E-value
Superfamily RNI-like 0.000000000785
Family 28-residue LRR 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032346m|PACid:19709892
Sequence length 486
Sequence
MKRNSKKHLCGAITKRTVRKVLLSNLPTDILSQILSWLPINDAVRTSILSREWKYVWRGH
TNLTFDSATMRKQYFKASFGYGFINATEFISRVDTVLRQHSGVEIKHMEVKHMLHNKHAN
HVDRWINVAIASKTKELIIDLNGGFKLSLSRDISRGIYRDKGEPYNIPPQLFSADNGPYL
QRLELTSVSLHLPADFKGFLNLKKLTLVDVSITDEDVQCMLSRCNLLEFFEIAYCRMVTS
IRMPKPLNQFKHLLVDKCPLLQVIELNCSLTVLEYTGTVVPLIFTSTCRLKNILIKFMTC
HAALDYMVTGFPSTLPSLETLTLHCAQRERIILPGKTFIFTHLRHLRLELVLLGNKKRHT
DVLDYAYLLEVAPFMEKLELLMWLCCQRRPYCKEDGELRSRPPHHHTHLKFVHISGFFGH
KDQVELALHILRSSIMLEKMEINPRVEIADCDESEKQFYEREQYVDGHRVATEYVCKADH
RNVVDA
Download sequence
Identical sequences K4A0F7
Si032346m|PACid:19709892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]